Enthusiasts.ciachef.edu is a subdomain of ciachef.edu, which was created on 1995-11-17,making it 29 years ago. It has several subdomains, such as blog.ciachef.edu , among others.
Description:Welcome CIA foodies! Explore cooking, baking, and wine classes for food enthusiasts, as well as our favorite recipes from the Culinary Institute of...
Discover enthusiasts.ciachef.edu website stats, rating, details and status online.Use our online tools to find owner and admin contact info. Find out where is server located.Read and write reviews or vote to improve it ranking. Check alliedvsaxis duplicates with related css, domain relations, most used words, social networks references. Go to regular site
HomePage size: 183.748 KB |
Page Load Time: 0.092564 Seconds |
Website IP Address: 13.68.134.142 |
CIA Culinary Blog | The Culinary Institute of America blog.ciachef.edu |
UWorld Accounting Certification Courses | CPA, CMA, & CIA Prep accounting.uworld.com |
Home - Polish Foodies shop.polishfoodies.com |
My Swiss Kitchen - Feeding Foodies in the Alps myswisskitchen.swisshikingvacations.com |
Hotel school, food service and culinary arts | Institut Paul Bocuse en.institutpaulbocuse.com |
North Texas Food Bank | NTFB.org - North Texas Food Bank - Feeding America - North Texas Food Bank web.ntfb.org |
Food Hacks — The web's best culinary innovations & shortcuts « Food Hacks :: WonderHowTo food-hacks.wonderhowto.com |
Culinary Connection Gifts - Culinary Connection shop.culinaryconnectiongifts.com |
CIA Editorial Photography editorial.ciastockphoto.com |
Safe Food, Fair Food | Safe Food, Fair Food in Africa safefoodfairfood.ilri.org |
Food Science Conference | Food Tech Webinars, Food Science Online Meetings, Food Technology 2020, Fo foodtech.madridge.com |
Culinary Getaways from Jovial Foods | Tuscany Culinary Vacations getaway.jovialfoods.com |
Freedom of Information Act Electronic Reading Room CIA foia.cia.gov |
Culinary Institute of America culinary.campusmaps.com |
Culinary Institute By Southwest University – Culinary Arts culinaryinstitute.southwestuniversity.edu |
CIA Foodies - Experience the World of Food with Culinary ... https://enthusiasts.ciachef.edu/ |
Gazpacho https://enthusiasts.ciachef.edu/gazpacho/ |
Orange-Chipotle Chicken Wings with Chipotle Sour Cream https://enthusiasts.ciachef.edu/orange |
Lemon Buttermilk Cake https://enthusiasts.ciachef.edu/lemon- |
Minestrone Recipe https://enthusiasts.ciachef.edu/minestrone/ |
CIA New York Dining Events https://enthusiasts.ciachef.edu/arriba/ |
Guacamole Recipe https://enthusiasts.ciachef.edu/guacamole |
Pan Bagnat Recipe https://enthusiasts.ciachef.edu/pan |
Vegetable Book https://enthusiasts.ciachef.edu/vegeta |
Main Dish Recipes https://enthusiasts.ciachef.edu/Maindishes/ |
Server: nginx |
Date: Tue, 14 May 2024 20:01:31 GMT |
Content-Type: text/html; charset=UTF-8 |
Transfer-Encoding: chunked |
Connection: keep-alive |
Vary: Accept-Encoding |
Expires: Thu, 19 Nov 1981 08:52:00 GMT |
Cache-Control: no-store, no-cache, must-revalidate |
Pragma: no-cache |
Surrogate-Key: front post-161226 post-user-13826 single |
Link: https://www.ciafoodies.com/wp-json/; rel="https://api.w.org/", https://www.ciafoodies.com/wp-json/wp/v2/pages/161226; rel="alternate"; type="application/json", https://www.ciafoodies.com/; rel=shortlink |
Set-Cookie: PHPSESSID=31315ba9638db7d12574d73896f2cc21; path=/ |
charset="utf-8"/ |
content="width=device-width, initial-scale=1.0" name="viewport"/ |
content="index, follow, max-image-preview:large, max-snippet:-1, max-video-preview:-1" name="robots" |
content="Welcome CIA foodies! Explore cooking, baking, and wine classes for food enthusiasts, as well as our favorite recipes from the Culinary Institute of America!" name="description" |
content="en_US" property="og:locale"/ |
content="website" property="og:type"/ |
content="CIA Foodies - Experience the World of Food with Culinary Institute of America" property="og:title"/ |
content="Welcome CIA foodies! Explore cooking, baking, and wine classes for food enthusiasts, as well as our favorite recipes from the Culinary Institute of America!" property="og:description"/ |
content="https://www.ciafoodies.com/" property="og:url"/ |
content="CIA Foodies" property="og:site_name"/ |
content="https://www.facebook.com/CIAFoodies/" property="article:publisher"/ |
content="2024-05-06T20:50:38+00:00" property="article:modified_time"/ |
content="https://www.ciafoodies.com/wp-content/uploads/2023/05/classes-at-cia.jpg" property="og:image"/ |
content="1920" property="og:image:width"/ |
content="600" property="og:image:height"/ |
content="image/jpeg" property="og:image:type"/ |
content="summary_large_image" name="twitter:card"/ |
content="FADDA0E3D7353B025D64010813B59B95" name="msvalidate.01"/ |
content="Y9gJmbM8ZQSZDX1vF4_kxxklJtgwceIzh9voT8SPezA" name="google-site-verification"/ |
content="MasterSlider 3.9.9 - Responsive Touch Image Slider | avt.li/msf" name="generator"/ |
content="Foodica Child 1.0.0" name="generator"/ |
content="WPZOOM Framework 1.9.19" name="generator"/ |
content="https://www.ciafoodies.com/wp-content/uploads/2022/06/cropped-favicon-fire-white-270x270.png" name="msapplication-TileImage"/ |
Ip Country: United States |
City Name: Washington |
Latitude: 38.7095 |
Longitude: -78.1539 |
LOCATIONS New York California CIA at Copia CIA Greystone Texas CLASSES Boot Camps Single-Day Classes Private Classes RESTAURANTS New York California Texas MEETINGS & WEDDINGS Weddings Corporate Meetings and Retreats Celebrations ABOUT CIA Gift Cards History of CIA FAQs DISH DISH Login DISH Home Weekly Menu Plan Recipes Recipe Library My Recipe Box Seasonal Guides Content Videos Chef’s Blog DISH Live Events E-Book Library Deals and Discounts FAQs Learn More HOME LOCATIONS New York California CIA at Copia CIA Greystone Texas CLASSES Boot Camps Single-Day Classes Private Classes RESTAURANTS New York California Texas MEETINGS & WEDDINGS Weddings Corporate Meetings and Retreats Celebrations ABOUT CIA Gift Cards History of CIA FAQs DISH DISH Login DISH Home Weekly Menu Plan Recipes Recipe Library My Recipe Box Seasonal Guides Content Videos Chef’s Blog DISH Live Events E-Book Library Deals and Discounts FAQs Learn MoreHome CIA Foodies Experience the World of Food with the Culinary Institute of America If you love food, you’re in the right place! Welcome to CIA for Enthusiasts, a place where you can cook, eat, celebrate, and learn at our campuses. From hands-on public cooking classes to exceptional dining experiences, CIA invites you to discover your inner chef with us. Four Culinary Destinations CIA New York Hyde Park, NY In the beautiful Hudson Valley. Explore CIA at Copia Napa, CA In bustling downtown Napa. Explore CIA Greystone St. Helena, CA In the stunning Napa Valley. Explore CIA Texas San Antonio, TX In the action-packed Pearl District. Explore Subscribe to Our Newsletter Sign up to be the first to know about upcoming classes, special events, dining experiences, and more at CIA. Sign Up Now Take a Class Hands-on, multi-day signature CIA Boot Camps, single-day classes, and beverage classes with CIA chef-instructors in state-of-the-art kitchens. Take a class that dives into distinct cuisines or helps you develop proper techniques in the kitchen. Learn More Dine With Us Elegant fine dining and elevated casual experiences brought to you by the students and faculty at CIA with locations in the Hudson Valley, Napa Valley, and San Antonio. Learn More Celebrate Something Special Unique, food-centric weddings, special occasions, celebrations, corporate events, meetings and more offered at multiple locations with a variety of different spaces. Learn More At CIA, a not-for-profit college, more than 90% of our students receive scholarships and other forms of financial aid. Your patronage helps support this important priority, ensuring students can realize their dreams of attending the world’s premier culinary college. If you are interested in enrolling in one of our degree programs at CIA, check out our college offerings. Learn moreSan Antonio, count your blessings and shout HALLELUJAH!!! We are so lucky to have CIA in our city. I have taken weekend classes at CIA numerous times and it never disappoints.” —Sonia H. CIA doesn’t disappoint. Been here in the past for some of their art exhibits. I love how they combine art, food and wine in such a fantastic way. Went to their 3D dinner which was a dinner intricately woven into a movie at your table.” —Linda H. What a fabulous institution and campus to visit and tour. So envious of those who get to study here. Located along the Hudson River, lush green everywhere, contemporary facilities, and the streets and parking lots named after food.” —Latha P. What’s Cooking at CIA? Find Your Inner Chef with DISH—Free Trial Inside! Transform your cooking with DISH! Start with a seven-day trial at no cost and discover the joy of home-cooked meals with our premium content. Subscribe during this limited-time offer and save 20%, plus get a free CIA-embroidered apron as a welcome gift. Learn More Guest Chef Dinner Series at The Grove Join Chef William Dissen ’03 on Thursday, May 23 for a chef’s dinner featuring recipes from the new south. We can’t wait to have him take over the kitchen at The Grove Restaurant at CIA at Copia in Napa! Learn More Hudson Valley Graduation Dinner Know someone special who is graduating college May 2024? Your graduate deserves a unique foodie celebration! Join us for our Hudson Valley Graduation Dinner at CIA New York for graduates from area colleges on Saturday, May 18. Your ticket includes a three-course dinner, open wine and beer bar, and passed hors d’oeuvre in the stunning Farquharson Hall. Learn More Copyright © 2024 The Culinary Institute of America At CIA, a not-for-profit college, more than 90% of our students receive scholarships and other forms of financial aid. Your patronage helps support this important priority, ensuring students can realize their dreams of attending the world’s premier culinary college. CIA Subscribe to our Email List Contact Us Terms of Use Privacy Policy Nondiscrimination Statement ","message_font_family":"","form_style":"style_0","form_layout":"bottom","form_bg_color":"","form_text_color":"","countdown_timer_style":"style_0","countdown_timer_bg_color":"","countdown_timer_text_color":"#000000","bg_color":"#c4d4a3","text_color":"#ffffff","cta_bg_color":"","cta_text_color":"","alt_cta_bg_color":"","alt_cta_text_color":"","position":"01","triggers":{"when_to_show":"duration_on_page","duration_on_page":"0","duration_on_site":"0","user_inactive_for":"0","scroll_to":"middle","when_to_hide":"button_click","hide_time":"","another_message":"another"},"id":"150155","delay_time":"0","retargeting":"","campaign_id":150154,"expiry_time":"","retargeting_clicked":"yes","expiry_time_clicked":"current_session","countdown_timer":"","countdown_timer_start":"","countdown_timer_end":"","title":"","cta_loader_img":"https:\/\/www.ciafoodies.com\/wp-content\/plugins\/icegram-engage\/pro\/classes\/..\/assets\/images\/spinner-2x.gif"}],"ajax_url":"https:\/\/www.ciafoodies.com\/wp-admin\/admin-ajax.php","defaults":{"icon":"https:\/\/www.ciafoodies.com\/wp-content\/plugins\/icegram-engage\/lite\/assets\/images\/icegram-logo-branding-64-grey.png","powered_by_logo":"","powered_by_text":""},"messages_to_show_after_trigger":[],"cta_proxy_nonce":"fe3a0d6376","scripts":["https:\/\/www.ciafoodies.com\/wp-content\/plugins\/icegram-engage\/lite\/assets\/js\/icegram.min.js?var=3.1.15","https:\/\/www.ciafoodies.com\/wp-content\/plugins\/icegram-engage\/pro\/classes\/..\/assets\/js\/frontend.js?ver=3.1.15"],"css":["https:\/\/www.ciafoodies.com\/wp-content\/plugins\/icegram-engage\/lite\/assets\/css\/frontend.min.css?var=3.1.15","https:\/\/www.ciafoodies.com\/wp-content\/plugins\/icegram-engage\/lite\/message-types\/action-bar\/themes\/action-bar.min.css?var=3.1.15","https:\/\/www.ciafoodies.com\/wp-content\/plugins\/icegram-engage\/lite\/message-types\/action-bar\/themes\/hello.css?var=3.1.15","https:\/\/www.ciafoodies.com\/wp-content\/plugins\/icegram-engage\/pro\/classes\/..\/assets\/css\/frontend-pro.css?ver=3.1.15"]}; /* ]]...
This Registry database contains ONLY .EDU domains. The data in the EDUCAUSE Whois database is provided by EDUCAUSE for information purposes in order to assist in the process of obtaining information about or related to .edu domain registration records. The EDUCAUSE Whois database is authoritative for the .EDU domain. A Web interface for the .EDU EDUCAUSE Whois Server is available at: http://whois.educause.edu By submitting a Whois query, you agree that this information will not be used to allow, enable, or otherwise support the transmission of unsolicited commercial advertising or solicitations via e-mail. The use of electronic processes to harvest information from this server is generally prohibited except as reasonably necessary to register or modify .edu domain names. Domain Name: CIACHEF.EDU The Culinary Institute of America 1946 Campus Drive Hyde Park, NY 12538-1499 USA Mike Romanovsky The Culinary Institute of America 1946 Campus Drive Hyde Park, NY 12538 USA +1.8454529600 m_romano@culinary.edu Mike Romanovsky The Culinary Institute of America 1946 Campus Drive Hyde Park, NY 12538 USA +1.8454529600 m_romano@culinary.edu NS4-07.AZURE-DNS.INFO NS2-07.AZURE-DNS.NET NS1-07.AZURE-DNS.COM NS3-07.AZURE-DNS.ORG Domain record activated: 17-Nov-1995 Domain record last updated: 08-Jun-2021 Domain expires: 31-Jul-2024